Methanosphaera sp. BMS: AW729_00185 Help Entry AW729_00185       CDS       T05504                                  Name (GenBank) hypothetical protein   KO K03622   DNA/RNA-binding protein Alba Organism metb  Methanosphaera sp. BMS Brite KEGG Orthology (KO) [BR:metb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:metb03036]     AW729_00185 Chromosome and associated proteins [BR:metb03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     AW729_00185 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Alba Rpp20 Motif Other DBs NCBI-ProteinID:  AWX33572 UniProt:  A0A2Z4LBH7 LinkDB All DBs Position 50411..50641 Genome browser AA seq 76 aa AA seqDB search MNYVLSIVTLMNKDVKRISIKARGKAINRAVDVAEVVRHKFVTKTQIEDILINTEELFRE DGSSSNVSTIDIILRV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgaattatgttttatcaatcgtcacattaatgaacaaagatgttaaaagaatcagcata aaagcaagaggaaaagctattaacagggctgtagatgttgcagaagtagtcagacacaaa tttgtgactaaaacccaaattgaagatattctaataaataccgaggaactattcagggaa gatggttcttcatcaaacgtttcaaccatagatattatactcagggtttaa

DBGET integrated database retrieval system