Methanothermobacter sp. CaT2: MTCT_0231 Help Entry MTCT_0231         CDS       T04009                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism metc  Methanothermobacter sp. CaT2 Pathway metc03010   Ribosome Brite KEGG Orthology (KO) [BR:metc00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MTCT_0231   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MTCT_0231  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:metc03011]     MTCT_0231    04121 Ubiquitin system [BR:metc04121]     MTCT_0231   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:metc04147]     MTCT_0231 Ribosome [BR:metc03011]  Ribosomal proteins   Eukaryotes    Small subunit     MTCT_0231   Archaea     MTCT_0231 Ubiquitin system [BR:metc04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MTCT_0231 Exosome [BR:metc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MTCT_0231   Exosomal proteins of colorectal cancer cells    MTCT_0231 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e NCD3G Alsin_RLD Baculo_ME53 Motif Other DBs NCBI-ProteinID:  BAM69480 LinkDB All DBs Position 192740..192895 Genome browser AA seq 51 aa AA seqDB search MKKFELYEVKGDKLVRKNPFCVRCSNGVFMADHGDRYACGKCGYTEWKNRE NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atgaagaagttcgaactctacgaggtaaagggggataaactcgtaaggaagaaccccttc tgtgtgagatgctcaaacggtgtcttcatggctgaccatggggacaggtacgcctgcggt aagtgcggatacaccgaatggaaaaacagggaatag

DBGET integrated database retrieval system