Methylobacterium sp. DM1: C0214_15745 Help Entry C0214_15745       CDS       T05461                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism metd  Methylobacterium sp. DM1 Pathway metd02024   Quorum sensing metd03018   RNA degradation Brite KEGG Orthology (KO) [BR:metd00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     C0214_15745  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     C0214_15745  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:metd03019]     C0214_15745    03036 Chromosome and associated proteins [BR:metd03036]     C0214_15745 Messenger RNA biogenesis [BR:metd03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      C0214_15745 Chromosome and associated proteins [BR:metd03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     C0214_15745 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 AcMNPV_AC11 Motif Other DBs NCBI-ProteinID:  AWI89583 LinkDB All DBs Position 3337585..3337839 Genome browser AA seq 84 aa AA seqDB search MAGERAQNLQDTFLNHVRKNKIPLTIFLVNGVKLQGVVTWFDNFCVLLRRDGHSQLVYKH AISTIMPGHPVQLFEPDETAPEKA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggcgggcgagcgcgctcagaacctccaggacacgttcctgaaccatgtccgcaaaaac aagatcccgctgacgatcttcctcgtcaatggcgtcaagcttcaaggtgtcgtgacctgg ttcgacaacttctgcgtcctgctccgccgcgacgggcactcgcagctcgtctacaagcac gcgatctcgacgatcatgccgggacacccggtgcaactgttcgagccggacgagacggcg cccgagaaggcgtga

DBGET integrated database retrieval system