Methanothermobacter sp. EMTCatA1: tca_00248 Help Entry tca_00248         CDS       T05328                                  Name (GenBank) hypothetical protein   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mete  Methanothermobacter sp. EMTCatA1 Pathway mete03010   Ribosome Brite KEGG Orthology (KO) [BR:mete00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     tca_00248   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     tca_00248  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mete03011]     tca_00248    04121 Ubiquitin system [BR:mete04121]     tca_00248   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mete04147]     tca_00248 Ribosome [BR:mete03011]  Ribosomal proteins   Eukaryotes    Small subunit     tca_00248   Archaea     tca_00248 Ubiquitin system [BR:mete04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    tca_00248 Exosome [BR:mete04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    tca_00248   Exosomal proteins of colorectal cancer cells    tca_00248 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e NCD3G Alsin_RLD Baculo_ME53 Motif Other DBs NCBI-ProteinID:  BAZ98323 LinkDB All DBs Position 204284..204439 Genome browser AA seq 51 aa AA seqDB search MKKFELYEVKDGKLVRKNPFCVRCSNGVFMADHGDRYACGKCGYTEWKNRE NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atgaagaaatttgagctctacgaggtcaaggacggtaaactcgtcaggaagaaccccttc tgtgtcaggtgctcaaacggtgtcttcatggcagaccatggggacaggtacgcctgcggt aaatgcggatacaccgaatggaaaaacagggaatag

DBGET integrated database retrieval system