Methanothermobacter sp. EMTCatA1: tca_00525 Help Entry tca_00525         CDS       T05328                                  Name (GenBank) hypothetical protein   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism mete  Methanothermobacter sp. EMTCatA1 Pathway mete03010   Ribosome Brite KEGG Orthology (KO) [BR:mete00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     tca_00525   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     tca_00525  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mete03011]     tca_00525    04121 Ubiquitin system [BR:mete04121]     tca_00525 Ribosome [BR:mete03011]  Ribosomal proteins   Eukaryotes    Large subunit     tca_00525   Archaea     tca_00525 Ubiquitin system [BR:mete04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    tca_00525 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Zn_Ribbon_1 Ribosomal_L40e DZR DZR_2 DHHC Zn_ribbon_RanBP Zn_ribbon_3 Motif Other DBs NCBI-ProteinID:  BAZ98600 LinkDB All DBs Position complement(498709..498855) Genome browser AA seq 48 aa AA seqDB search MARFEEAENRLFNIKICLKCNARNPPTAKTCRKCGYKGLRYKAKEPRG NT seq 147 nt NT seq  +upstreamnt  +downstreamnt atggcaaggtttgaggaagcagaaaacagactgttcaatatcaagatctgccttaaatgt aacgctaggaacccaccaactgcaaagacatgcaggaagtgtggttacaaggggttaagg tacaaggccaaggaaccaaggggttaa

DBGET integrated database retrieval system