Methanothermobacter sp. EMTCatA1: tca_01642 Help Entry tca_01642         CDS       T05328                                  Name (GenBank) hypothetical protein   KO K24450   DNA-binding protein Organism mete  Methanothermobacter sp. EMTCatA1 Brite KEGG Orthology (KO) [BR:mete00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mete03036]     tca_01642 Chromosome and associated proteins [BR:mete03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     tca_01642 SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone TAF CENP-T_C CENP-S TFIID_20kDa Bromo_TP TFIID-31kDa LonB_AAA-LID DUF1931 HK97-gp10_like DUF5471 Motif Other DBs NCBI-ProteinID:  BAZ99687 LinkDB All DBs Position complement(1524300..1524506) Genome browser AA seq 68 aa AA seqDB search MAELPIAPVGRIIKNAGAQRISDDAREALAKILEEKGEEIAKEAVKLAKHAGRKTVKSSD IELAAKKL NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggccgaattacccatagcaccagttgggagaatcataaaaaatgccggtgcccagaga ataagcgacgacgcaagggaagcacttgcaaagattctggaagaaaaaggcgaagaaata gcaaaagaagctgttaaacttgcaaagcacgccggcagaaaaactgttaaatcatcagac atagaactggccgctaaaaagttatag

DBGET integrated database retrieval system