KEGG   Methyloligella sp. GL2: HT051_05845
Entry
HT051_05845       CDS       T06641                                 
Symbol
petA
Name
(GenBank) ubiquinol-cytochrome c reductase iron-sulfur subunit
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
metg  Methyloligella sp. GL2
Pathway
metg00190  Oxidative phosphorylation
metg01100  Metabolic pathways
metg02020  Two-component system
metg04148  Efferocytosis
Module
metg_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:metg00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    HT051_05845 (petA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HT051_05845 (petA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    HT051_05845 (petA)
Enzymes [BR:metg01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     HT051_05845 (petA)
SSDB
Motif
Pfam: UCR_Fe-S_N Rieske
Other DBs
NCBI-ProteinID: QKP77015
LinkDB
Position
1252583..1253167
AA seq 194 aa
MSTSITEDDEDVSRRDVILITAGGFAGVLGVASIWPLLDQMNPDSSAQALATTEVDLSHM
ERGQAITVMWRGKPIFIRYRTDDEVAAGKDVPLSELPDKVARNANLPDDAPATDENRAAE
GKEPWLVMIGICTHLGCIPDGQAPGSNKGEFGGWFCPCHGSQYDTAGRIRKGPAPENMAI
PPYAFTGDTKIKIG
NT seq 585 nt   +upstreamnt  +downstreamnt
atgagcacatccattaccgaagacgacgaagacgtttcgcgccgcgacgtgatcctgatc
accgctggcgggttcgcgggcgttctgggcgtggcctcgatctggccgctgctggatcag
atgaaccccgacagctcggcgcaggcgctggcgacgacggaggtcgatctcagccatatg
gagcgcggccaggcgatcaccgtgatgtggcgcggcaagccgatcttcatccgctaccgt
accgacgacgaggtcgccgccggcaaggacgtgccgctttcggagcttcccgacaaggtg
gcgcgcaacgccaacctgccggacgacgccccggccacggacgagaaccgcgccgcggaa
ggcaaggaaccctggctggtgatgatcggcatctgcacgcatctgggctgcattcccgac
gggcaggcgcccggctccaataaaggcgagttcggcggctggttctgcccgtgccacggc
tcgcaatacgacaccgccggacgcatccgcaaaggcccggcgccggagaatatggcgatc
ccgccttacgcctttaccggcgacaccaagatcaagatcggctga

DBGET integrated database retrieval system