Methyloligella sp. GL2: HT051_08385 Help Entry HT051_08385       CDS       T06641                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism metg  Methyloligella sp. GL2 Pathway metg01100   Metabolic pathways metg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:metg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HT051_08385    00074 Mycolic acid biosynthesis     HT051_08385   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HT051_08385 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  QKP77466 UniProt:  A0A6N0DTT3 LinkDB All DBs Position 1770260..1770496 Genome browser AA seq 78 aa AA seqDB search MSDISERVKKIVVEHLGVEADKVTENASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA ETILTVGDAIKFLEKNSS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatctcggagcgtgttaagaagatcgttgtggagcatcttggcgtagaagcc gataaggtaaccgagaatgccagcttcattgacgacctgggtgccgatagcctggatacg gtcgaactcgtgatggcattcgaagaagaattcggatgcgagattcccgatgatgccgcc gagaccattttgacggtcggcgatgccatcaagtttctcgaaaagaacagctcctaa

DBGET integrated database retrieval system