Methanobacterium sp. MB1: MBMB1_0019 Help Entry MBMB1_0019        CDS       T02957                                  Name (GenBank) hypothetical protein   KO K03622   DNA/RNA-binding protein Alba Organism meth  Methanobacterium sp. MB1 Brite KEGG Orthology (KO) [BR:meth00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:meth03036]     MBMB1_0019 Chromosome and associated proteins [BR:meth03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     MBMB1_0019 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Alba Rpp20 Motif Other DBs NCBI-ProteinID:  CDG64139 UniProt:  U6EBI7 LinkDB All DBs Position 17092..17373 Genome browser AA seq 93 aa AA seqDB search MSEENVVYIGNKPVMNYVLAVVTQMNGGTPKVILKARGRAISRAVDVAEIVRNRFITDVN IGRIDICTEEIMNNEGTSTNVSAIEIQLSKGLS NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgtcagaggaaaatgtggtatacattggaaacaaaccggtaatgaactatgtattggct gtagtaacacaaatgaacggcggtactcctaaagtaatactaaaagcaaggggaagagcc atttctcgcgcagttgacgtagcagagattgtcagaaacagatttattactgatgtgaat atcggccgtattgacatctgcactgaagaaattatgaacaatgagggaacctcaaccaac gtttcagccattgaaatacaactttccaaagggcttagttaa

DBGET integrated database retrieval system