Methanobacterium sp. MB1: MBMB1_0446 Help Entry MBMB1_0446        CDS       T02957                                  Name (GenBank) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism meth  Methanobacterium sp. MB1 Pathway meth03060   Protein export meth04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:meth00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     MBMB1_0446    04141 Protein processing in endoplasmic reticulum     MBMB1_0446  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     MBMB1_0446  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:meth04131]     MBMB1_0446   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:meth02044]     MBMB1_0446 Membrane trafficking [BR:meth04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     MBMB1_0446 Secretion system [BR:meth02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    MBMB1_0446 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecE DUF2207_C Motif Other DBs NCBI-ProteinID:  CDG64556 UniProt:  U6E9W0 LinkDB All DBs Position complement(434701..434889) Genome browser AA seq 62 aa AA seqDB search MNLNKESMANFIKQCQRVLKVSKKPDREEYINVAKVTGIGIILIGVIGFIISIVAQLIQG TG NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atgaatttaaacaaagaatcaatggcaaattttataaaacagtgccagagagtgttaaaa gtctctaaaaaaccagatagagaagagtacataaatgtagccaaggtgactggtattggc attatcctgatcggagtaattggattcataatcagtatagtggcccaacttattcaaggt acaggataa

DBGET integrated database retrieval system