Methanobacterium sp. MB1: MBMB1_0886 Help Entry MBMB1_0886        CDS       T02957                                  Name (GenBank) hypothetical protein   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism meth  Methanobacterium sp. MB1 Pathway meth00362   Benzoate degradation meth01100   Metabolic pathways meth01120   Microbial metabolism in diverse environments meth01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:meth00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     MBMB1_0886    00622 Xylene degradation     MBMB1_0886    00621 Dioxin degradation     MBMB1_0886 Enzymes [BR:meth01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      MBMB1_0886 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 RRF MORF_dom RWD Motif Other DBs NCBI-ProteinID:  CDG64988 UniProt:  U6EDA2 LinkDB All DBs Position 865601..865795 Genome browser AA seq 64 aa AA seqDB search MPVITIDVPPMSKEQKKEMVEKFATTASEILGLPVQSIVTIIREVEAENVGVGDKLLCDC DMSH NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgccagttataactatagatgttcctcccatgagtaaggaacagaaaaaagagatggtt gagaaatttgccacaactgccagtgaaatactaggacttccagtccagtccattgtgacc ataatacgggaagtggaagccgaaaatgtgggagtgggagataaactgctctgtgattgt gatatgtcccattaa

DBGET integrated database retrieval system