Methanobacterium sp. MB1: MBMB1_1386 Help Entry MBMB1_1386        CDS       T02957                                  Name (GenBank) hypothetical protein   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism meth  Methanobacterium sp. MB1 Pathway meth03010   Ribosome Brite KEGG Orthology (KO) [BR:meth00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MBMB1_1386   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MBMB1_1386  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:meth03011]     MBMB1_1386    04121 Ubiquitin system [BR:meth04121]     MBMB1_1386   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:meth04147]     MBMB1_1386 Ribosome [BR:meth03011]  Ribosomal proteins   Eukaryotes    Small subunit     MBMB1_1386   Archaea     MBMB1_1386 Ubiquitin system [BR:meth04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MBMB1_1386 Exosome [BR:meth04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MBMB1_1386   Exosomal proteins of colorectal cancer cells    MBMB1_1386 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 NCD3G Ribosomal_L37e Alsin_RLD HypA Motif Other DBs NCBI-ProteinID:  CDG65484 LinkDB All DBs Position 1365118..1365282 Genome browser AA seq 54 aa AA seqDB search MKKFELYEVKDNKIIRKNPECVRCSHGVFMADHGDRYACGKCGYTQWKNKEGQK NT seq 165 nt NT seq  +upstreamnt  +downstreamnt atgaaaaaatttgaattgtacgaagttaaagataataaaatcatccgtaaaaacccagaa tgtgtacgatgttcccatggtgtcttcatggccgatcacggagaccgttacgcctgcggg aaatgcggttacacccagtggaaaaataaagaaggtcagaaataa

DBGET integrated database retrieval system