Methanothermobacter sp. THM-2: FZP68_04870 Help Entry FZP68_04870       CDS       T07724                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism metj  Methanothermobacter sp. THM-2 Pathway metj03010   Ribosome Brite KEGG Orthology (KO) [BR:metj00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     FZP68_04870   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     FZP68_04870  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:metj03011]     FZP68_04870    04121 Ubiquitin system [BR:metj04121]     FZP68_04870 Ribosome [BR:metj03011]  Ribosomal proteins   Eukaryotes    Large subunit     FZP68_04870   Archaea     FZP68_04870 Ubiquitin system [BR:metj04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    FZP68_04870 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Zn_Ribbon_1 Ribosomal_L40e DZR DZR_2 DHHC Zn_ribbon_RanBP Zn_ribbon_3 Motif Other DBs NCBI-ProteinID:  QHN08125 UniProt:  A0A6B9TKC0 LinkDB All DBs Position complement(950363..950509) Genome browser AA seq 48 aa AA seqDB search MARFEEAENRLFNIKICLKCNARNPPTAKTCRKCGYKGLRYKAKEPRG NT seq 147 nt NT seq  +upstreamnt  +downstreamnt atggcaagatttgaggaagcagaaaacagactattcaatatcaagatctgccttaaatgt aacgccaggaacccaccaactgcaaagacatgcaggaagtgcggttacaagggattaagg tacaaggcaaaggaaccaaggggttaa

DBGET integrated database retrieval system