Methanothermobacter sp. THM-2: FZP68_08285 Help Entry FZP68_08285       CDS       T07724                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism metj  Methanothermobacter sp. THM-2 Pathway metj03010   Ribosome Brite KEGG Orthology (KO) [BR:metj00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     FZP68_08285   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     FZP68_08285  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:metj03011]     FZP68_08285    04121 Ubiquitin system [BR:metj04121]     FZP68_08285   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:metj04147]     FZP68_08285 Ribosome [BR:metj03011]  Ribosomal proteins   Eukaryotes    Small subunit     FZP68_08285   Archaea     FZP68_08285 Ubiquitin system [BR:metj04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    FZP68_08285 Exosome [BR:metj04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    FZP68_08285   Exosomal proteins of colorectal cancer cells    FZP68_08285 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e NCD3G Alsin_RLD Baculo_ME53 Motif Other DBs NCBI-ProteinID:  QHN08711 LinkDB All DBs Position 1555607..1555762 Genome browser AA seq 51 aa AA seqDB search MKKFELYEVKGDKLVRKNPFCVRCSNGVFMADHGDRYACGKCGYTEWKNRE NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atgaagaagttcgaactctacgaggtaaagggggataaactcgtaaggaagaaccccttc tgtgtgagatgctcaaacggtgtcttcatggctgaccatggggacaggtacgcctgcggt aaatgcggatacaccgaatggaaaaacagggaatag

DBGET integrated database retrieval system