Methanothermobacter sp. KEPCO-1: FVF72_00960 Help Entry FVF72_00960       CDS       T06317                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism metk  Methanothermobacter sp. KEPCO-1 Pathway metk03010   Ribosome Brite KEGG Orthology (KO) [BR:metk00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     FVF72_00960   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     FVF72_00960  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:metk03011]     FVF72_00960    04121 Ubiquitin system [BR:metk04121]     FVF72_00960   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:metk04147]     FVF72_00960 Ribosome [BR:metk03011]  Ribosomal proteins   Eukaryotes    Small subunit     FVF72_00960   Archaea     FVF72_00960 Ubiquitin system [BR:metk04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    FVF72_00960 Exosome [BR:metk04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    FVF72_00960   Exosomal proteins of colorectal cancer cells    FVF72_00960 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e NCD3G Alsin_RLD Baculo_ME53 Motif Other DBs NCBI-ProteinID:  QEF93849 LinkDB All DBs Position complement(205511..205666) Genome browser AA seq 51 aa AA seqDB search MKKFELYEVKGDKLVRKNPFCVRCSNGVFMADHGDRYACGKCGYTEWKNRE NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atgaagaagttcgaactctacgaggtaaagggggataaactcgtaaggaagaaccccttc tgtgtgagatgctcaaacggtgtcttcatggctgaccatggggacaggtacgcctgcggt aaatgcggatacaccgaatggaaaaacagggaatag

DBGET integrated database retrieval system