Methanothermobacter sp. KEPCO-1: FVF72_02970 Help Entry FVF72_02970       CDS       T06317                                  Name (GenBank) pyruvate synthase   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism metk  Methanothermobacter sp. KEPCO-1 Pathway metk00010   Glycolysis / Gluconeogenesis metk00020   Citrate cycle (TCA cycle) metk00620   Pyruvate metabolism metk00633   Nitrotoluene degradation metk00640   Propanoate metabolism metk00650   Butanoate metabolism metk00680   Methane metabolism metk00720   Other carbon fixation pathways metk01100   Metabolic pathways metk01110   Biosynthesis of secondary metabolites metk01120   Microbial metabolism in diverse environments metk01200   Carbon metabolism metk01210   2-Oxocarboxylic acid metabolism Module metk_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA metk_M00620   Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate Brite KEGG Orthology (KO) [BR:metk00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     FVF72_02970    00020 Citrate cycle (TCA cycle)     FVF72_02970    00620 Pyruvate metabolism     FVF72_02970    00640 Propanoate metabolism     FVF72_02970    00650 Butanoate metabolism     FVF72_02970   09102 Energy metabolism    00720 Other carbon fixation pathways     FVF72_02970    00680 Methane metabolism     FVF72_02970   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     FVF72_02970 Enzymes [BR:metk01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase (ferredoxin)      FVF72_02970 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_6 Fer4_2 Fer4_21 Fer4_10 Fer4_9 Fer4_16 Fer4_4 Fer4_8 LdpA_Fe-S-bd Fer4_18 Fer4_13 Fer4_22 Fer4_3 Fer4_17 Fer4_15 NosR stn_TNFRSF12A Motif Other DBs NCBI-ProteinID:  QEF94208 LinkDB All DBs Position 551299..551544 Genome browser AA seq 81 aa AA seqDB search MESLGATVREPGSTRKNKTGSWRTFKPFLDKDKCIDCDNCILFCPEGCIDKEHEIDYDYC KGCGICAEECPVKAIKMEREK NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggaatcacttggagcaaccgtcagagaaccaggaagcacccgtaaaaacaagacgggg agctggagaacattcaaaccattccttgataaggataaatgtatagactgtgataactgc atccttttctgtcccgaaggctgcatagataaggagcatgagattgactacgattactgt aagggatgcgggatatgcgcagaggaatgccctgttaaggcaattaagatggagagagaa aaatag

DBGET integrated database retrieval system