Methanothermobacter sp. KEPCO-1: FVF72_08755 Help Entry FVF72_08755       CDS       T06317                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism metk  Methanothermobacter sp. KEPCO-1 Pathway metk03010   Ribosome Brite KEGG Orthology (KO) [BR:metk00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     FVF72_08755   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     FVF72_08755  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:metk03011]     FVF72_08755    04121 Ubiquitin system [BR:metk04121]     FVF72_08755 Ribosome [BR:metk03011]  Ribosomal proteins   Eukaryotes    Large subunit     FVF72_08755   Archaea     FVF72_08755 Ubiquitin system [BR:metk04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    FVF72_08755 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Zn_Ribbon_1 Ribosomal_L40e DZR DZR_2 DHHC Zn_ribbon_RanBP Zn_ribbon_3 Motif Other DBs NCBI-ProteinID:  QEF95229 UniProt:  A0A5B9M6C1 LinkDB All DBs Position 1624212..1624358 Genome browser AA seq 48 aa AA seqDB search MARFEEAENRLFNIKICLKCNARNPPTAKTCRKCGYKGLRYKAKEPRG NT seq 147 nt NT seq  +upstreamnt  +downstreamnt atggcaagatttgaggaagcagaaaacagactattcaatatcaagatctgccttaaatgt aacgccaggaacccaccaactgcaaagacatgcaggaagtgcggttacaagggattaagg tacaaggcaaaggaaccaaggggttaa

DBGET integrated database retrieval system