Methylomonas sp. LW13: U737_03955 Help Entry U737_03955        CDS       T05879                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism metl  Methylomonas sp. LW13 Pathway metl01100   Metabolic pathways metl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:metl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     U737_03955    00074 Mycolic acid biosynthesis     U737_03955   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     U737_03955 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QBC26140 LinkDB All DBs Position complement(902542..902799) Genome browser AA seq 85 aa AA seqDB search MSEMETELKHLIIDTLALEDVDAADIDSHAALFNDGLGLDSIDALELGLAIRKKYQVKID AERDDVVKIFGSVAALAQFIEAARS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagcgagatggaaactgaattaaaacacctgattatcgacacgctggcgctggaagat gtcgatgcggcggacatcgacagccacgccgcgctgttcaacgacggcctgggcctggac tctatagacgcactggaactgggattggcgatacgtaaaaagtatcaggtaaaaattgat gccgaacgcgacgatgtggtgaaaatcttcggttccgtggcggccttggcacagtttatc gaagcagcgcggagttga

DBGET integrated database retrieval system