Methylomonas sp. LW13: U737_04965 Help Entry U737_04965        CDS       T05879                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism metl  Methylomonas sp. LW13 Pathway metl01100   Metabolic pathways metl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:metl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     U737_04965    00074 Mycolic acid biosynthesis     U737_04965   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     U737_04965 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH DUF1896 Gag_p24_C Motif Other DBs NCBI-ProteinID:  QBC26322 LinkDB All DBs Position 1105620..1105853 Genome browser AA seq 77 aa AA seqDB search MSNIEERVKKIVAEQLGVKEEIANDASFVDDLGADSLDTVELVMALEEEFECEIPDEEAE KITTVQLAIDYINANLQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtaatatcgaagaacgagtaaaaaagattgtcgcagaacaattaggcgtaaaagaa gaaatcgcgaacgatgcgtcttttgttgacgatcttggtgctgattctttagacacagtt gaactcgtcatggctctggaagaagaattcgaatgcgaaattccagacgaagaagctgaa aaaatcaccacagtccaattggctatcgattacatcaacgccaatctgcagtaa

DBGET integrated database retrieval system