Methylomonas sp. LW13: U737_06045 Help Entry U737_06045        CDS       T05879                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism metl  Methylomonas sp. LW13 Brite KEGG Orthology (KO) [BR:metl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:metl03032]     U737_06045    03036 Chromosome and associated proteins [BR:metl03036]     U737_06045    03400 DNA repair and recombination proteins [BR:metl03400]     U737_06045 DNA replication proteins [BR:metl03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     U737_06045 Chromosome and associated proteins [BR:metl03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     U737_06045 DNA repair and recombination proteins [BR:metl03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       U737_06045 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_1 HU-CCDC81_euk_2 Lmo2446-like_N HU-DNA_bdg Motif Other DBs NCBI-ProteinID:  QBC26515 LinkDB All DBs Position 1342476..1342748 Genome browser AA seq 90 aa AA seqDB search MNKSELIDAIASASQLTKADAGRALDGFIKAVEDALKQGDSVALVGFGTFDVKERAERKG RNPQTGEEITIKAAKIPSFKAGKSLKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataaatcggaacttatcgatgcaatcgccagtgcgtcccagttaactaaagctgat gcagggcgggctttagatggttttatcaaagcagtagaagatgctttgaaacaaggtgat tccgttgccttggttggcttcggcacattcgatgttaaagaaagagcagagcgtaaaggc cgcaatccgcagaccggtgaagagatcaccattaaagccgcgaaaattccttcatttaaa gctggcaaatctttaaaagatgctgtaaactag

DBGET integrated database retrieval system