Methylomonas sp. LW13: U737_20320 Help Entry U737_20320        CDS       T05879                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism metl  Methylomonas sp. LW13 Brite KEGG Orthology (KO) [BR:metl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:metl03036]     U737_20320 Chromosome and associated proteins [BR:metl03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     U737_20320 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB Taxilin COG3_N HALZ BLYB NRBF2 CATRA-C YabA DUF7603 DivIC APG6_N V_ATPase_I Motif Other DBs NCBI-ProteinID:  QBC29061 LinkDB All DBs Position complement(4453280..4453507) Genome browser AA seq 75 aa AA seqDB search MSQTEKDPSTELEALEAKLDTLIAQFNQVKSENKSLKVKQDALVKEKAKLLEKTTLAKTR VEAMIARLKAMEHDS NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgtctcaaacagaaaaagatccgtcaaccgaactggaagcattggaagcgaaactggat acgctcattgcccagttcaatcaagtcaaaagcgagaataagtccttgaaagttaaacag gatgccttggttaaggaaaaagccaagctgctggaaaaaaccacgttggccaaaacccgg gtggaagcgatgattgcccgcttgaaagccatggagcatgattcgtga

DBGET integrated database retrieval system