Methanosarcina sp. MTP4: MSMTP_0422 Help Entry MSMTP_0422        CDS       T03850                                  Name (GenBank) LSU ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism metm  Methanosarcina sp. MTP4 Pathway metm03010   Ribosome Brite KEGG Orthology (KO) [BR:metm00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MSMTP_0422   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MSMTP_0422  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:metm03011]     MSMTP_0422    04121 Ubiquitin system [BR:metm04121]     MSMTP_0422 Ribosome [BR:metm03011]  Ribosomal proteins   Eukaryotes    Large subunit     MSMTP_0422   Archaea     MSMTP_0422 Ubiquitin system [BR:metm04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MSMTP_0422 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 DZR DZR_2 zf-AtTam37 Cas12f1-like_TNB Zn_ribbon_ZPR1 Zn_ribbon_RPAB4 Zn_ribbon_3 Zn_ribbon_RanBP Zn_ribbon_LapB zf-ChsH2 Motif Other DBs NCBI-ProteinID:  AKB23891 UniProt:  A0A0E3L5U7 LinkDB All DBs Position complement(504848..504997) Genome browser AA seq 49 aa AA seqDB search MARFPEAEERLLNKKICMKCNARNAVRATRCRKCGYEGLRVKSKESKGA NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggctagattcccagaagcagaagaaaggttactaaacaaaaagatctgcatgaaatgc aatgccagaaacgcagtaagggcgacccgctgcaggaaatgtggctacgaaggccttcgc gtaaaatccaaggaatccaagggagcatga

DBGET integrated database retrieval system