Methanosarcina sp. MTP4: MSMTP_2750 Help Entry MSMTP_2750        CDS       T03850                                  Name (GenBank) Archaeal histone   KO K24450   DNA-binding protein Organism metm  Methanosarcina sp. MTP4 Brite KEGG Orthology (KO) [BR:metm00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:metm03036]     MSMTP_2750 Chromosome and associated proteins [BR:metm03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     MSMTP_2750 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone Bromo_TP TFIID-31kDa CENP-T_C CENP-S TAF TFIID-18kDa LonB_AAA-LID DUF1931 Peptidase_C39 PCP_red TFIID_20kDa Motif Other DBs NCBI-ProteinID:  AKB26219 UniProt:  A0A0E3NZ12 LinkDB All DBs Position 3592976..3593185 Genome browser AA seq 69 aa AA seqDB search MAKVIPFAPIERLVRTAGAQRVSESAGMALTEILEEYGLEISREAIKLAEHAGRKTVKAE DIKLAKEML NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggctaaagttataccatttgcaccaatagaacgtttagtaagaactgcaggagctcag agagtcagtgaaagcgcagggatggcccttacggagattctggaagaatacgggcttgag atatccagagaagctataaaacttgcagaacatgcaggcagaaaaaccgtaaaagccgaa gatataaaattagcaaaagaaatgctgtaa

DBGET integrated database retrieval system