Methanobacterium sp. BAmetb5: CIT02_11045 Help Entry CIT02_11045       CDS       T05745                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism meto  Methanobacterium sp. BAmetb5 Pathway meto03010   Ribosome Brite KEGG Orthology (KO) [BR:meto00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     CIT02_11045   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     CIT02_11045  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:meto03011]     CIT02_11045    04121 Ubiquitin system [BR:meto04121]     CIT02_11045   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:meto04147]     CIT02_11045 Ribosome [BR:meto03011]  Ribosomal proteins   Eukaryotes    Small subunit     CIT02_11045   Archaea     CIT02_11045 Ubiquitin system [BR:meto04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    CIT02_11045 Exosome [BR:meto04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    CIT02_11045   Exosomal proteins of colorectal cancer cells    CIT02_11045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 NCD3G Alsin_RLD Motif Other DBs NCBI-ProteinID:  AXV40808 LinkDB All DBs Position complement(2242209..2242373) Genome browser AA seq 54 aa AA seqDB search MKKFELYEVKDNKIIRKNPECVRCSHGVFMADHGDRYACGKCGYTQWKGKEGKK NT seq 165 nt NT seq  +upstreamnt  +downstreamnt atgaaaaaatttgaattgtacgaagttaaagataacaaaatcatccgtaaaaacccagaa tgtgtacgatgctcccatggtgtcttcatggccgatcacggagaccgttacgcctgtgga aaatgcggttacacccagtggaaaggtaaagaaggtaaaaaataa

DBGET integrated database retrieval system