KEGG   Methylibium sp. Pch-M: C1M51_11525
Entry
C1M51_11525       CDS       T05827                                 

Name
(GenBank) PQQ-dependent dehydrogenase, methanol/ethanol family
  KO
K20937  1-butanol dehydrogenase (quinone) [EC:1.1.5.11]
Organism
metp  Methylibium sp. Pch-M
Brite
KEGG Orthology (KO) [BR:metp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C1M51_11525
Enzymes [BR:metp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.11  1-butanol dehydrogenase (quinone)
     C1M51_11525
SSDB
Motif
Pfam: PQQ PQQ_2 PQQ_3 ANAPC4_WD40
Other DBs
NCBI-ProteinID: QAZ39998
UniProt: A0A4P6H0Q5
LinkDB
Position
complement(2413790..2415646)
AA seq 618 aa
MSKHPVRHALSVAAALAVLGLSQGAHAVKNVTWEDISNDDRTSTDVLSYGLGLKAQRYSP
LKQISTANVQKLVPAWSHSFGGEKQRGQEGQVLVHDGVIYATSSYSRFTALDAKTGRQLW
TYEHRLPDDIRPCCDVVNRGPAIYGDKVYFGTLDARVVALDRATGKVVWNEKFGDHKVGY
TMTGAPFIVKDKKSGRVLLIHGSSGDEFGVVGWLFARDPDTGAEVWARPMVEGHMGRLNG
KDSTVTGDAKAPSWPRDKDGKLVEAWHQGGGAPWQTASFDAENNTIVIGTGNPAPWNTWK
RTKEGDDPRNWDSLFTSGQAYVDASTGELKGFFQHTPNDAWDFSGNNSIVLFEYKDPKSG
KLVKAGAHADRNGFFFVTDREKLATGAGYPNKPTALLGAWPFVDGITWAKGFDLKTGKPI
ENNNRPPAPKPGTDKGESIFVSPPFLGGTNWMPMSYSPDTGLFYIPANHWAMDYWTEHLT
YKAGSAYLGQGFRIKRLYEDHVGTLRAIDPVTGKIAWEHKEKLPLWAGTMTTAGGLLFTG
TSDGYVKAFDSKTGKELWKFQTGSGVVSVPVTWEQDGEQYVGIQSGYGGAVPLWGGDMAE
MTKKVTQGGSMWVFKLPK
NT seq 1857 nt   +upstreamnt  +downstreamnt
atgagcaagcatcccgtccgtcacgccctgtccgtcgcagcggcgctggccgtcctggga
ctgtcccagggcgcgcacgccgtcaagaacgtcacctgggaagacatctcgaacgacgac
cgcacgagcaccgacgtcctaagctacggtctgggcctgaaggcccagcgctacagcccg
ctgaagcagatatcgaccgccaacgtgcagaagctcgtcccggcatggagccactccttc
ggcggcgagaagcaacgcggccaggaaggccaggtgctggtgcacgacggcgtgatctac
gcgaccagttcctactcgcgcttcacggcgctcgacgcgaagaccggccggcagctgtgg
acctacgaacaccgcctgcccgacgacatccgtccgtgctgcgacgtcgtcaaccgcggc
cccgccatctacggcgacaaggtctacttcggtacgctcgacgcgcgcgtcgtggcgctg
gaccgggccaccggcaaggtggtgtggaacgagaagttcggtgaccacaaggtcggctac
acgatgaccggcgcgcccttcatcgtgaaggacaagaagtccggtcgggtgctgctgatc
cacggctcgtcgggcgacgagttcggcgtcgtcggctggctgttcgcacgcgatcccgac
accggcgccgaggtctgggcccgcccgatggtcgagggccacatgggccgcctgaacggc
aaggacagcacggtgaccggcgatgcgaaggccccctcgtggccgcgtgacaaggacggc
aagctggtcgaggcgtggcaccagggcggcggcgcgccgtggcagaccgcgtcgttcgat
gccgagaacaacaccatcgtgatcggcaccggcaacccggcgccgtggaacacctggaag
cgcaccaaggaaggcgacgacccgcgcaactgggacagcctgttcacctcgggtcaggcc
tacgtcgatgcgtcgaccggcgaactcaagggcttcttccagcacacgccgaacgatgcc
tgggacttctcgggcaacaactcgatcgtgctgttcgagtacaaggatccgaagtccggc
aagctggtgaaggccggcgcgcatgccgaccgcaacggcttcttcttcgtgaccgaccgc
gagaagctcgcgaccggcgccggctatccgaacaagccgaccgcgctgctcggtgcgtgg
ccgttcgtcgacggcatcacctgggccaagggtttcgacctgaagaccggcaagccgatc
gagaacaacaaccgtccgccggcccccaagcccggcaccgacaagggcgagtcgatcttc
gtgtcgccgccgttcctgggcggcaccaactggatgccgatgagctacagcccggacacc
ggcctgttctacatcccggcgaaccactgggcgatggactactggaccgagcacctgacc
tacaaggccggctccgcctacctcggccagggcttccgcatcaagcggctgtacgaggac
cacgtcggcacgctgcgggcgatcgacccggtcaccggcaagatcgcatgggaacacaag
gagaagctgccgctgtgggccggcacgatgacgacggccggcggcctgctgttcacgggc
acctccgacggctacgtgaaggccttcgacagcaagaccggcaaggaactgtggaagttc
cagaccggctcgggcgtggtctcggtcccggtgacctgggaacaggacggcgagcagtac
gtcggcatccagtcgggctacggcggcgccgtgcccctgtggggcggtgacatggccgag
atgaccaagaaggtcactcagggcggctcgatgtgggtcttcaagctgcccaagtaa

DBGET integrated database retrieval system