Methylorubrum sp. GM97: MSPGM_33010 Help Entry MSPGM_33010       CDS       T10720                                  Symbol groS5_1 Name (GenBank) 10 kDa chaperonin 5   KO K04078   chaperonin GroES Organism metq  Methylorubrum sp. GM97 Brite KEGG Orthology (KO) [BR:metq00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:metq03110]     MSPGM_33010 (groS5_1)    03029 Mitochondrial biogenesis [BR:metq03029]     MSPGM_33010 (groS5_1) Chaperones and folding catalysts [BR:metq03110]  Heat shock proteins   HSP10    MSPGM_33010 (groS5_1) Mitochondrial biogenesis [BR:metq03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     MSPGM_33010 (groS5_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 PQQ Motif Other DBs NCBI-ProteinID:  BDL40711 LinkDB All DBs Position complement(3593350..3593640) Genome browser AA seq 96 aa AA seqDB search MAFRPLHDRVLLRRIESDERTKGGIIIPDTAKEKPQEGEVVAVGPGARDDQGRVTALDVK TGDRVLFGKWSGTEIKVDGQDLLILKESDILGVIAA NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcgtttcgacccctgcacgaccgcgtactgctgcgccgcattgagagcgacgagcgg acgaagggtggcatcatcatccccgacaccgcgaaggagaagccgcaggagggtgaggtc gtggccgtcggacccggtgcccgcgacgaccagggccgcgtcaccgcgctggacgtcaag accggcgaccgcgtgctgttcggcaagtggtccggcaccgagatcaaggtcgacggccag gatctcctgatcctcaaggaatccgacattctcggcgtgatcgccgcctga

DBGET integrated database retrieval system