Methyloversatilis sp. RAC08: BSY238_933 Help Entry BSY238_933        CDS       T04449                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism metr  Methyloversatilis sp. RAC08 Brite KEGG Orthology (KO) [BR:metr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:metr03036]     BSY238_933 (ftsL) Chromosome and associated proteins [BR:metr03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     BSY238_933 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL Conotoxin Chi-conotoxin Motif Other DBs NCBI-ProteinID:  AOF82653 UniProt:  A0A1B3LP74 LinkDB All DBs Position 1017980..1018255 Genome browser AA seq 91 aa AA seqDB search MLRLHVVLILLLLASAISLVSAQHRSRSLHTQLEREHQRMRMLETEWGQLQIEQGTLAAH ARISDLAETKLKMRAPARNQVIVLDSPEAAQ NT seq 276 nt NT seq  +upstreamnt  +downstreamnt gtgctgcgccttcatgtcgtcctgatcctgctgctgcttgccagcgccatttcactggtg tccgcacaacatcgctcgcgcagcctgcacacgcagctcgaacgcgagcaccagcgcatg cgcatgctggaaaccgagtgggggcaactgcagatcgaacagggcacgctggccgctcac gcgcgcatttccgacctcgcggaaacaaagctgaaaatgcgcgcaccggctcgcaatcag gtcatcgtgctcgacagtccggaggccgcgcaatga

DBGET integrated database retrieval system