Methylobacterium durans: DK389_15430 Help Entry DK389_15430       CDS       T05724                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism mets  Methylobacterium durans Pathway mets00190   Oxidative phosphorylation mets01100   Metabolic pathways Module mets_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:mets00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     DK389_15430  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:mets00194]     DK389_15430 Photosynthesis proteins [BR:mets00194]  Photosystem and electron transport system   F-type ATPase [OT]    DK389_15430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  AWN41641 UniProt:  A0A2U8W7Q1 LinkDB All DBs Position complement(3330972..3331199) Genome browser AA seq 75 aa AA seqDB search MDPVAAKYIGAGLACLGMAGAGIGLGNLFGQFLAGALRNPSAADGQRATLLLGFALTEAL GIFSLLIALLLLFAV NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggatcccgtcgctgcgaagtacatcggcgccggcctcgcctgcctcggcatggcgggt gcgggcatcggcctcggcaacctcttcggtcagttcctcgccggcgcccttcgcaacccc tccgcggccgacggccagcgcgccaccctgctcctgggcttcgccctcaccgaggcgctc ggcatcttctcgctgctgatcgcgctcctgctgctcttcgccgtctga

DBGET integrated database retrieval system