Methanobacterium sp. BRmetb2: CIT01_10240 Help Entry CIT01_10240       CDS       T05692                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mett  Methanobacterium sp. BRmetb2 Pathway mett03010   Ribosome Brite KEGG Orthology (KO) [BR:mett00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     CIT01_10240   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     CIT01_10240  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mett03011]     CIT01_10240    04121 Ubiquitin system [BR:mett04121]     CIT01_10240   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mett04147]     CIT01_10240 Ribosome [BR:mett03011]  Ribosomal proteins   Eukaryotes    Small subunit     CIT01_10240   Archaea     CIT01_10240 Ubiquitin system [BR:mett04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    CIT01_10240 Exosome [BR:mett04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    CIT01_10240   Exosomal proteins of colorectal cancer cells    CIT01_10240 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e Baculo_ME53 zf-C3HC4_4 Motif Other DBs NCBI-ProteinID:  AXV38558 LinkDB All DBs Position complement(2035930..2036091) Genome browser AA seq 53 aa AA seqDB search MKKSELYEVKDNKIIRKNPFCVRCSSGVFMADHGDRFACGKCGYTEWKTKEKQ NT seq 162 nt NT seq  +upstreamnt  +downstreamnt atgaaaaagagtgaactctatgaggttaaagataacaaaataattagaaaaaatcctttc tgtgtaagatgttccagcggagtcttcatggctgaccatggagatcgatttgcatgtgga aaatgtggatacactgaatggaaaactaaagaaaaacaataa

DBGET integrated database retrieval system