Methylococcus geothermalis: GNH96_07150 Help Entry GNH96_07150       CDS       T06585                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism metu  Methylococcus geothermalis Pathway metu01100   Metabolic pathways metu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:metu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GNH96_07150 (acpP)    00074 Mycolic acid biosynthesis     GNH96_07150 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GNH96_07150 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QJD29768 UniProt:  A0A858Q7D9 LinkDB All DBs Position 1498197..1498427 Genome browser AA seq 76 aa AA seqDB search MSDIAERVKKIVAEQLGVKDEISNEASFVDDLGADSLDTVELVMALEEEFECEIPDEDAE KITTVQQAIDYIQSHT NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagtgatatagcagaacgtgtaaagaagatcgtcgccgaacagttgggcgtgaaggac gaaatctcgaacgaggcttcctttgtggacgatctgggcgccgattctctggacacggtc gagctggtcatggctctcgaagaagagttcgagtgcgaaattcctgacgaggacgccgaa aagatcaccacggttcagcaggcgatcgattacatccagagccatacctga

DBGET integrated database retrieval system