Methylococcus geothermalis: GNH96_07825 Help Entry GNH96_07825       CDS       T06585                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism metu  Methylococcus geothermalis Brite KEGG Orthology (KO) [BR:metu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:metu03110]     GNH96_07825 (grxC) Chaperones and folding catalysts [BR:metu03110]  Protein folding catalysts   Protein disulfide isomerase    GNH96_07825 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Glrx-like GST_N_2 Motif Other DBs NCBI-ProteinID:  QJD29891 UniProt:  A0A858Q7V4 LinkDB All DBs Position 1614477..1614740 Genome browser AA seq 87 aa AA seqDB search MPSVRMYSTAMCPFCSAAERLLKSKGVSEIEKIRVDLDASRLQEMIAITRRRTVPQIFIG DRHVGGFDDLAALEHAGQLDELLSGTA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgccctctgtccgcatgtacagcactgccatgtgccctttctgctcggcggccgaacgg ctgctgaagtccaagggcgtgtccgagatcgaaaagatcagggtcgacttggacgcctcc agactccaggaaatgatcgcgatcacccgccggcgcaccgtgccgcagattttcatcggt gaccggcacgtgggcgggttcgacgatctcgccgcgttggaacacgccggccagttggac gaactgctgtccggaacggcctga

DBGET integrated database retrieval system