Methylococcus geothermalis: GNH96_13270 Help Entry GNH96_13270       CDS       T06585                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism metu  Methylococcus geothermalis Pathway metu01100   Metabolic pathways metu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:metu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GNH96_13270    00074 Mycolic acid biosynthesis     GNH96_13270   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GNH96_13270 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QJD30840 UniProt:  A0A858QAH8 LinkDB All DBs Position complement(2871693..2871965) Genome browser AA seq 90 aa AA seqDB search MTLANETLEREVTDLVISTLNLDVSPEAVDPEAPLYREGLGLDSIDILEIALVVSKRYGF QLRADNEDNVRIFGSLRSLSQHIAVHRVEC NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgacgctcgcgaacgagacgctcgagcgtgaggtgacggatctggtgatctccaccctg aatctggacgtcagccccgaggccgtcgatccggaagcgcccttgtatcgcgagggactc ggcctggattcgatcgacatcctggagatcgcgctggtcgtttccaaacgttacggcttc caattgcgggcggacaacgaggacaacgtccgaatcttcggttcgctgcgcagtctgtct cagcatatcgcggtccaccgggtcgagtgttga

DBGET integrated database retrieval system