Methylococcus geothermalis: GNH96_13740
Help
Entry
GNH96_13740 CDS
T06585
Name
(GenBank) NADH-quinone oxidoreductase subunit M
KO
K00342
NADH-quinone oxidoreductase subunit M [EC:
7.1.1.2
]
Organism
metu
Methylococcus geothermalis
Pathway
metu00190
Oxidative phosphorylation
metu01100
Metabolic pathways
Module
metu_M00144
NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:
metu00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
GNH96_13740
Enzymes [BR:
metu01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.2 NADH:ubiquinone reductase (H+-translocating)
GNH96_13740
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Proton_antipo_M
Oxidored_q5_N
DUF3742
Motif
Other DBs
NCBI-ProteinID:
QJD30918
UniProt:
A0A858QAK2
LinkDB
All DBs
Position
complement(2962750..2964303)
Genome browser
AA seq
517 aa
AA seq
DB search
MTGEIPWSELTGFPVLSTLIGLPLVFMLAALRADRAARAWAIGFAGAVAELGVALFLLSR
FDAGTADFQFTEHTVFLSLLNYHLGIDGISLGFVLLTALLTVLVLLFREIGKDGPCGLFV
ATVLACEATAMGMFLALDLAQFWIAACLEPWPIALILGRWGGGDPAGAARRVYMRFAGMG
LALLGGGILLLGLGHARATGIWSFDLAALLAAPPSGTLESLIFVLLFYGFSVRLAQFPLH
GWLPIVAEQGVPATALAVLAGMKIGIYGLLRFVLPLLPNAVHEWTEWALGLALAGMFYGA
VLALMQLNFRRLMAFATVSQTGMLVAGVFALNLEGLSGTLLLAFNFGAAGAGLFFIAGML
RRRTGTLLLPRLGGLFESLPGPGLLFLVAALSTIAMPGTPGFDAAHLLLEGLIESRGLGA
AIAVAVGNVLAAGFLLWAFQRIFLAHRRSHRPYRGWPPLQWREHALIVSLCLVLLGVGFY
TAPWLHLAHQALVRLAQVHSLPSAALPASARPSAHPA
NT seq
1554 nt
NT seq
+upstream
nt +downstream
nt
atgacgggcgagataccttggtccgaactcaccggcttcccggtgctcagcaccctgatc
ggccttccgctggtgttcatgctggcggcgctgcgggcggaccgcgccgcccgggcttgg
gcgatcggcttcgccggcgccgttgcggaactcggggtggccctgttcctcctgagccgg
ttcgacgcgggcaccgccgatttccagttcaccgagcacacggtgttcctgtccctcctg
aattaccatctgggcatcgacggcatcagcttggggttcgtcctgctgaccgcgttgctg
acggtgctggtcctgctgttccgggaaatcgggaaggacgggccttgcggcctgttcgtg
gcgaccgtgttggcctgcgaggcgacggcgatgggcatgtttctcgccctggacctggcc
cagttctggattgccgcctgtctggagccgtggccgatcgccttgatcctcgggcgctgg
ggcggcggcgatccggcgggcgcggcccggcgggtttatatgcgctttgccggcatgggt
ttggcgctgctgggtggaggcatcctgttgctggggctgggtcatgcgcgcgccaccggc
atctggtcgttcgacctggcggcgctgctggcagcgccgccatccggcacgctcgaatcc
ctgatcttcgtgctgctgttctatggattctcggtgcgcttggcgcagttcccgctgcac
ggctggctgcccatcgtcgcggaacagggcgtaccggccaccgccttggccgttttggcg
ggcatgaaaatcggcatctatggcctgctgcgcttcgtgctgccgctgctccccaacgcg
gttcacgaatggaccgaatgggctctgggcttggccctggcgggcatgttctacggtgcg
gtgcttgcgctgatgcagctcaatttccggcggctcatggcgtttgcgacggtcagtcaa
accgggatgctggtggcgggggtcttcgccctgaacctcgaaggcttgagcggcacgctg
ctgctggcattcaatttcggcgcggcgggtgcgggactgttcttcatcgccggcatgctc
cggcgccgcaccggcacgctgttgctgccgcgcctgggtgggctgttcgaatcgctgccg
gggccgggcctgctgttcctggtcgccgccctgagcaccatcgccatgccgggcacgccg
ggcttcgacgccgcccacctgctgctggaagggctgatcgaaagccgtggcctgggggcg
gcgatcgcggtcgccgtgggcaacgtgctggccgccggtttcctgctgtgggcgttccag
cgcatctttctcgcgcatcgccgttcgcaccggccttaccgcggatggccgccgctccag
tggcgcgaacacgccttgatcgtctcgctgtgcctggtgttgctgggggtggggttctac
accgcgccctggcttcatctcgcccatcaggcgctggtccggctggcacaggtgcacagc
ctgccgtccgcggcgctgccggcctctgcgcggccatccgcccaccccgcatga
DBGET
integrated database retrieval system