Methanobrevibacter sp. TLL-48-HuF1: K4897_01425 Help Entry K4897_01425       CDS       T08254                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism metv  Methanobrevibacter sp. TLL-48-HuF1 Pathway metv03010   Ribosome Brite KEGG Orthology (KO) [BR:metv00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     K4897_01425   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     K4897_01425  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:metv03011]     K4897_01425    04121 Ubiquitin system [BR:metv04121]     K4897_01425   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:metv04147]     K4897_01425 Ribosome [BR:metv03011]  Ribosomal proteins   Eukaryotes    Small subunit     K4897_01425   Archaea     K4897_01425 Ubiquitin system [BR:metv04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    K4897_01425 Exosome [BR:metv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    K4897_01425   Exosomal proteins of colorectal cancer cells    K4897_01425 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_Nudix Ribosomal_L37e Zn_ribbon_IS1595 Phage_zn_bind_2 Zn_Ribbon_TF Cas12f1-like_TNB Zn_ribbon_TiaS Motif Other DBs NCBI-ProteinID:  URN49687 UniProt:  A0A9E7IP51 LinkDB All DBs Position complement(300051..300206) Genome browser AA seq 51 aa AA seqDB search MVKKSDLYKVDGDKIERKNPVCPRCSDGVFMADHGNRYACGKCGYTEMKKD NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atggtaaaaaaatctgatctttacaaagtagacggagataaaatcgaaagaaaaaaccca gtatgtcctcgttgttctgatggtgtatttatggctgatcatggtaatagatatgcatgc ggtaaatgtggatacactgaaatgaaaaaagattaa

DBGET integrated database retrieval system