Methanosarcina sp. 795: AAY43_01555 Help Entry AAY43_01555       CDS       T10855                                  Symbol rpl40e Name (GenBank) 50S ribosomal protein L40   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism metw  Methanosarcina sp. 795 Pathway metw03010   Ribosome Brite KEGG Orthology (KO) [BR:metw00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     AAY43_01555 (rpl40e)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     AAY43_01555 (rpl40e)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:metw03011]     AAY43_01555 (rpl40e)    04121 Ubiquitin system [BR:metw04121]     AAY43_01555 (rpl40e) Ribosome [BR:metw03011]  Ribosomal proteins   Eukaryotes    Large subunit     AAY43_01555 (rpl40e)   Archaea     AAY43_01555 (rpl40e) Ubiquitin system [BR:metw04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    AAY43_01555 (rpl40e) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L40e DZR zf-AtTam37 DZR_2 Zn_ribbon_RPAB4 HVO_0416 Zn_ribbon_RanBP Zn_Ribbon_1 zf-ChsH2 HypA DUF7129 DHHC DUF7577 Motif Other DBs NCBI-ProteinID:  ALK04628 LinkDB All DBs Position 351519..351668 Genome browser AA seq 49 aa AA seqDB search MARFPEAEERLLNKKICMKCNARNAIRATRCRKCGSSALRVKSKESKGA NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggctcgttttccagaagcagaagaaagattattaaataagaaaatttgtatgaagtgt aatgccaggaatgcaataagagcaacccgctgcagaaaatgcggcagcagtgctcttcgg gttaaatccaaggaatccaagggagcatga

DBGET integrated database retrieval system