Phytobacter sp. MRY16-398: MRY16398_21070 Help Entry MRY16398_21070    CDS       T05735                                  Name (GenBank) anti-sigma-28 factor FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism mety  Phytobacter sp. MRY16-398 Pathway mety02020   Two-component system mety02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:mety00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     MRY16398_21070  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     MRY16398_21070  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:mety02035]     MRY16398_21070 Bacterial motility proteins [BR:mety02035]  Flagellar system   Flagellar assembly proteins    Others     MRY16398_21070 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  BBE77051 UniProt:  A0A348DC34 LinkDB All DBs Position complement(2220321..2220611) Genome browser AA seq 96 aa AA seqDB search MSIDRTSPLKPVSTVQPRETSDTQATKVRLEKSKTANSTSVTLSDAQSKLMQPGSSDVNM ERVEQLKTAIRNGELKMDTGKIADALINEVQSYLSK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgagcattgatcgtacatcgcctttaaagccggttagcaccgtacaaccacgtgaaacc agcgacacccaggcaacgaaagtacgtctggaaaaatcgaaaaccgccaacagcacgagc gtaacgctcagtgatgcccaatccaaattgatgcagccgggtagcagcgacgtcaatatg gaacgcgttgaacaactgaaaacggcaatccgtaatggtgagctaaagatggacaccggt aaaatcgccgatgccctgattaacgaagtgcagagttacttgagtaaataa

DBGET integrated database retrieval system