Methanothermobacter sp. MT-2: METMT2_0714 Help Entry METMT2_0714       CDS       T05694                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism metz  Methanothermobacter sp. MT-2 Pathway metz03010   Ribosome Brite KEGG Orthology (KO) [BR:metz00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     METMT2_0714   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     METMT2_0714  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:metz03011]     METMT2_0714    04121 Ubiquitin system [BR:metz04121]     METMT2_0714   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:metz04147]     METMT2_0714 Ribosome [BR:metz03011]  Ribosomal proteins   Eukaryotes    Small subunit     METMT2_0714   Archaea     METMT2_0714 Ubiquitin system [BR:metz04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    METMT2_0714 Exosome [BR:metz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    METMT2_0714   Exosomal proteins of colorectal cancer cells    METMT2_0714 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Phage_zn_bind_2 Ribosomal_L37e Zn_ribbon_Nudix Zn_Ribbon_TF Zn_ribbon_IS1595 Motif Other DBs NCBI-ProteinID:  BAW31416 UniProt:  A0A3G9CZM2 LinkDB All DBs Position 681470..681622 Genome browser AA seq 50 aa AA seqDB search MSKHRLYEVKDDKIKRKNPFCPRCSSGVFMADHGDRYACGKCGYTQWKNR NT seq 153 nt NT seq  +upstreamnt  +downstreamnt atgagcaaacatagattatatgaagtcaaagacgataaaatcaagagaaagaacccattc tgtcccagatgttcaagtggagttttcatggcagaccatggggacagatacgcctgtgga aagtgtggatacacccaatggaaaaacaggtag

DBGET integrated database retrieval system