Methylophilus sp. TWE2: ACJ67_03640 Help Entry ACJ67_03640       CDS       T04002                                  Name (GenBank) glutaredoxin   KO K03676   glutaredoxin 3 Organism meu  Methylophilus sp. TWE2 Brite KEGG Orthology (KO) [BR:meu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:meu03110]     ACJ67_03640 Chaperones and folding catalysts [BR:meu03110]  Protein folding catalysts   Protein disulfide isomerase    ACJ67_03640 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Glrx-like DSBA Thioredoxin_4 Thioredoxin_2 GST_N_2 Thioredoxin_3 SH3BGR Motif Other DBs NCBI-ProteinID:  AKR42623 UniProt:  A0A0K0STK8 LinkDB All DBs Position 757982..758239 Genome browser AA seq 85 aa AA seqDB search MAKVVMYTSAVCPYCMNAERLLKNKGVTEIEKIRVDLQPELRAEMMEKTGRRTVPQIFIG DHHVGGFDDLHALDVQGGLDPLLAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggctaaagtcgtaatgtatacctcagcagtctgcccatactgcatgaatgcggagcgc ttgctcaaaaacaagggcgtgaccgagattgaaaaaatccgtgtcgatttgcagcctgaa ctgcgtgctgaaatgatggagaaaactggccgccgcacggtaccgcagatatttatcggt gaccatcatgtgggcggttttgatgacctgcatgcgctggatgtgcagggtgggctggat ccattgctggccgcatag

DBGET integrated database retrieval system