Methylophilus sp. TWE2: ACJ67_06025 Help Entry ACJ67_06025       CDS       T04002                                  Name (GenBank) prepilin peptidase   KO K02686   primosomal replication protein N Organism meu  Methylophilus sp. TWE2 Pathway meu03440   Homologous recombination Brite KEGG Orthology (KO) [BR:meu00001]  09120 Genetic Information Processing   09124 Replication and repair    03440 Homologous recombination     ACJ67_06025  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:meu03400]     ACJ67_06025 DNA repair and recombination proteins [BR:meu03400]  Prokaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     RecBC pathway proteins      ACJ67_06025 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SSB_1 SSB Motif Other DBs NCBI-ProteinID:  AKR43030 UniProt:  A0A0K0SUS0 LinkDB All DBs Position 1242324..1242614 Genome browser AA seq 96 aa AA seqDB search MNTLVIAATIHSVEALRYTPAGLPLLRLQLQHDSEQQEAGMSRKVQCQLPAVIIGEKANL PLQSGDQIKVKGFLAQRSAKSTQVVLHIQELQRIQY NT seq 291 nt NT seq  +upstreamnt  +downstreamnt gtgaatacgctggtgatcgcggcaaccattcactctgttgaagcgttgcgttacacaccg gcaggcttacccttgttgcgattgcaattgcaacacgattcagaacagcaagaagccggg atgagtcggaaagtgcagtgtcagttacccgcagtgattattggtgaaaaagccaattta ccattgcaaagcggcgatcagatcaaagtcaaaggttttttggcgcagcgcagtgcaaag agcacacaagtggtactgcacatacaagagttacagcgaatacagtattaa

DBGET integrated database retrieval system