Methylophilus sp. TWE2: ACJ67_07310 Help Entry ACJ67_07310       CDS       T04002                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism meu  Methylophilus sp. TWE2 Pathway meu00998   Biosynthesis of various antibiotics meu01100   Metabolic pathways meu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:meu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ACJ67_07310    00074 Mycolic acid biosynthesis     ACJ67_07310   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ACJ67_07310 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF6137 DUF1896 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  AKR43254 UniProt:  A0A0K0SVK0 LinkDB All DBs Position 1502637..1502873 Genome browser AA seq 78 aa AA seqDB search MSDIEQRVKKIVCEQLGANEADVKNTSSFVDDLGADSLDTVELVMALEEEFDCEIPDEEA EKITTVQQAIDYVNANLK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtccgacatcgaacaacgcgtaaagaaaatcgtttgtgaacaattaggtgcaaacgaa gctgacgtaaaaaacacatcatctttcgtggatgatctgggtgcagattctctggacacc gtagaattagtgatggctttggaagaggaattcgattgcgaaattcctgacgaagaagct gaaaaaatcacaaccgtgcagcaagcgattgactacgtcaacgcaaacctcaagtaa

DBGET integrated database retrieval system