Methylomonas sp. UP202: QC632_09700 Help Entry QC632_09700       CDS       T10336                                  Symbol queF Name (GenBank) preQ(1) synthase   KO K09457   7-cyano-7-deazaguanine reductase [EC:1.7.1.13] Organism meup  Methylomonas sp. UP202 Pathway meup00790   Folate biosynthesis meup01100   Metabolic pathways Module meup_M00988   PreQ1 biosynthesis, GTP => 7-Aminomethyl-7-deazaguanine Brite KEGG Orthology (KO) [BR:meup00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     QC632_09700 (queF)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:meup03016]     QC632_09700 (queF) Enzymes [BR:meup01000]  1. Oxidoreductases   1.7  Acting on other nitrogenous compounds as donors    1.7.1  With NAD+ or NADP+ as acceptor     1.7.1.13  preQ1 synthase      QC632_09700 (queF) Transfer RNA biogenesis [BR:meup03016]  Prokaryotic type   tRNA modification factors    Other tRNA modification factors     QC632_09700 (queF) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  QueF NUP120_helical Motif Other DBs NCBI-ProteinID:  WGS88015 LinkDB All DBs Position complement(2227362..2227751) Genome browser AA seq 129 aa AA seqDB search MSTQPSSDLTTFENPRPARDFTIRIDIPEFTCLCPMTGQPDFAKLTLEYVPDRLCVELKS LKLYMWTFRERGAFHEAVTNEILDHIAAATQPNFMRLRADFNVRGGIYTTVVVEHRNPAW QAPTPVQLP NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagtacccaacccagttccgacctgaccactttcgaaaatcccagaccggcgcgcgat ttcacgatccgtatcgacattccggagttcacctgtttgtgcccgatgaccggccagccg gatttcgccaaattgacgctcgaatacgtgccggatcggctgtgcgtcgaattgaaatcg ctaaaactgtatatgtggaccttccgcgagcgcggcgccttccacgaagcggtcaccaac gaaattctcgatcacatcgccgcggcgacccaaccgaatttcatgcgcttgcgcgccgac ttcaatgtgcgcggcgggatctatacgacggtggtcgtcgaacatcgcaacccggcttgg caagcgccgacgccggtccagttgccctga

DBGET integrated database retrieval system