Methylomonas sp. UP202: QC632_15660 Help Entry QC632_15660       CDS       T10336                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism meup  Methylomonas sp. UP202 Pathway meup01100   Metabolic pathways meup01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:meup00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QC632_15660 (acpP)    00074 Mycolic acid biosynthesis     QC632_15660 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QC632_15660 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C HLH DUF1896 Gag_p24_C Motif Other DBs NCBI-ProteinID:  WGS84485 LinkDB All DBs Position complement(3502433..3502666) Genome browser AA seq 77 aa AA seqDB search MSNIEERVKKIVAEQLGVKEEIANDASFVDDLGADSLDTVELVMALEEEFECEIPDEEAE KITTVQLAIDYINANLQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtaatatcgaagaacgagtaaaaaagattgtcgcggaacaattaggcgtaaaggaa gaaatcgcaaacgatgcgtcttttgttgacgatcttggcgctgattctttagacacagtt gaacttgtcatggctctggaagaagaattcgagtgcgaaattccggacgaagaagccgaa aaaatcaccaccgtccaattggctatcgattacatcaacgccaacttgcaataa

DBGET integrated database retrieval system