KEGG   Mesorhizobium sp. WSM4906: QAZ22_10130
Entry
QAZ22_10130       CDS       T10806                                 
Symbol
phnC
Name
(GenBank) phosphonate ABC transporter ATP-binding protein
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
mewm  Mesorhizobium sp. WSM4906
Pathway
mewm02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mewm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    QAZ22_10130 (phnC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mewm02000]
    QAZ22_10130 (phnC)
Enzymes [BR:mewm01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     QAZ22_10130 (phnC)
Transporters [BR:mewm02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    QAZ22_10130 (phnC)
SSDB
Motif
Pfam: ABC_tran AAA_29 AAA_21 AAA_16 ATP-synt_ab AAA_22 Adeno_IVa2 RsgA_GTPase nSTAND1 ABC_ATPase MMR_HSR1 NB-ARC DO-GTPase2 AAA_30 Zeta_toxin AAA_23 DUF87 AAA_15 nSTAND3
Other DBs
NCBI-ProteinID: WFP78113
LinkDB
Position
complement(2135049..2135906)
AA seq 285 aa
MSASSATLEIRGVTRRFGKNTAVSDINVSIPQGQMVGIIGRSGAGKSTLLRMINRLIDPS
QGSIFFDGAEVSSLQGSPLRRWQRDCAMIFQQFNLVPRLDVLTNVLLGRLNHRSTLSNLL
GMFSRTECAEAVAALERLDIARTALQPAGTLSGGQQQRVAIARAMMQQPKVLLADEPIAS
LDPLNAKVVMDSLRDINLREGITVVTNLHTLDTARAYCNRIIGMAAGKVVFDGAPEDLDR
DAVRTVYGADANGVEISEAITSTAVNIKPKITASAGTLEPAFPGY
NT seq 858 nt   +upstreamnt  +downstreamnt
atgtcagcatcatcggccacgctggaaatccgcggcgtaacccgacgatttggcaagaac
accgctgtcagcgacatcaacgtctcgatcccgcagggccagatggtcggcatcatcggc
cgctccggcgccggcaagtcgacgcttctgcgcatgatcaaccgtctcatcgaccctagc
caggggtcgattttttttgacggcgccgaggtttccagcctgcagggctcgccgctgcgt
cgctggcagcgcgactgcgccatgattttccagcagttcaacctcgtgccgcgcctcgac
gtgctgaccaacgtgctgctcggccgcctcaaccatcgctcgacgctttcaaacctgctc
ggcatgttctcgcgcaccgaatgcgcagaggcggtggccgcgctcgagcgcctcgatatc
gcccgcaccgcgctgcagccggccggcacgctgtccggcggccagcagcagcgcgtggcg
atcgcgcgcgccatgatgcagcagccgaaggtgcttctggccgacgagccgatcgcctcg
ctcgacccgctcaacgccaaggtggtgatggactcgctgcgcgacatcaatttgcgcgaa
ggcatcaccgtcgtcaccaacctgcacacgctggacaccgcccgcgcctactgcaaccgc
atcatcggcatggccgccggcaaagtcgtattcgacggcgcaccggaggatctcgaccgc
gatgccgtgcgcaccgtctatggcgccgacgccaacggggtcgagatctccgaggccatc
acgtcgaccgccgtcaacatcaagccgaagatcaccgcatccgccggaacgctcgaaccg
gccttccctggctattga

DBGET integrated database retrieval system