Methanobrevibacter sp. YE315: TL18_06050 Help Entry TL18_06050        CDS       T04279                                  Name (GenBank) 30S ribosomal protein S27   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism meye  Methanobrevibacter sp. YE315 Pathway meye03010   Ribosome Brite KEGG Orthology (KO) [BR:meye00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     TL18_06050   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     TL18_06050  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:meye03011]     TL18_06050    04121 Ubiquitin system [BR:meye04121]     TL18_06050   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:meye04147]     TL18_06050 Ribosome [BR:meye03011]  Ribosomal proteins   Eukaryotes    Small subunit     TL18_06050   Archaea     TL18_06050 Ubiquitin system [BR:meye04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    TL18_06050 Exosome [BR:meye04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    TL18_06050   Exosomal proteins of colorectal cancer cells    TL18_06050 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e Zn_ribbon_NUD Zn_ribbon_RPAB4 Cas12f1-like_TNB Lar_restr_allev DZR MqsA_antitoxin Zn_ribbon_IS1595 Zn_Ribbon_TF Zn_ribbon_13 DZR_2 A2L_zn_ribbon Zn_ribbon_LysW Motif Other DBs NCBI-ProteinID:  AMD17617 LinkDB All DBs Position complement(1354337..1354489) Genome browser AA seq 50 aa AA seqDB search MVRKSDLYEVDGDKIVRKNQICPRCGEGVFMADHGDRVACGKCGYTEMKK NT seq 153 nt NT seq  +upstreamnt  +downstreamnt atggtaagaaaatctgatttatatgaagttgatggagacaaaattgtaagaaaaaaccaa atttgtcctcgttgtggtgaaggtgtattcatggctgaccatggtgacagagttgcttgt ggtaaatgcggatacactgaaatgaaaaaataa

DBGET integrated database retrieval system