Myxococcus fulvus: MFUL124B02_18520 Help Entry MFUL124B02_18520  CDS       T06896                                  Name (GenBank) primosome subunit DnaD   KO K03116   sec-independent protein translocase protein TatA Organism mfb  Myxococcus fulvus Pathway mfb03060   Protein export mfb03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:mfb00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     MFUL124B02_18520  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     MFUL124B02_18520  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:mfb02044]     MFUL124B02_18520 Secretion system [BR:mfb02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    MFUL124B02_18520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E MotB_plug Motif Other DBs NCBI-ProteinID:  AKF81174 LinkDB All DBs Position complement(4615660..4615902) Genome browser AA seq 80 aa AA seqDB search MLGLKPMELLLILFVLLLLFGATRLPQLGSSLGSAIRNFKRGFGGEEDAGTPGADKKGGN LASGGNVDKDVKSSSPSSHA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgctggggctgaagccgatggaacttcttctcatcctgtttgtgctgctgctcctcttc ggggccacgcggctgccgcagctcggctcgtccctgggcagcgcgattcgcaacttcaag cgcggcttcggcggcgaggaggacgcgggtacgcccggcgccgacaagaagggcggcaac ctggccagcggcggcaacgtggacaaggacgtgaagtcctcgtcccccagcagccacgcc tga

DBGET integrated database retrieval system