Methanobacterium formicicum BRM9: BRM9_0612 Help Entry BRM9_0612         CDS       T03396                                  Name (GenBank) ribosomal protein S27ae Rps27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mfc  Methanobacterium formicicum BRM9 Pathway mfc03010   Ribosome Brite KEGG Orthology (KO) [BR:mfc00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     BRM9_0612   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     BRM9_0612  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mfc03011]     BRM9_0612    04121 Ubiquitin system [BR:mfc04121]     BRM9_0612   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mfc04147]     BRM9_0612 Ribosome [BR:mfc03011]  Ribosomal proteins   Eukaryotes    Small subunit     BRM9_0612   Archaea     BRM9_0612 Ubiquitin system [BR:mfc04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    BRM9_0612 Exosome [BR:mfc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    BRM9_0612   Exosomal proteins of colorectal cancer cells    BRM9_0612 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 NCD3G Alsin_RLD Motif Other DBs NCBI-ProteinID:  AIS31435 UniProt:  A0A089ZEZ4 LinkDB All DBs Position 618212..618376 Genome browser AA seq 54 aa AA seqDB search MKKFELYEVKDNKIIRKNPECVRCSHGVFMADHGDRYACGKCGYTQWKGKEGKK NT seq 165 nt NT seq  +upstreamnt  +downstreamnt atgaaaaaatttgaattgtacgaagttaaagataacaaaatcatccgtaaaaacccagaa tgtgtacgatgctcccatggtgtcttcatggccgatcatggagaccgttacgcctgtgga aaatgcggttacacccagtggaaaggtaaagaaggtaagaaataa

DBGET integrated database retrieval system