Methanocaldococcus fervens: Mefer_0876 Help Entry Mefer_0876        CDS       T00976                                  Name (GenBank) Ribosomal protein S27a   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mfe  Methanocaldococcus fervens Pathway mfe03010   Ribosome Brite KEGG Orthology (KO) [BR:mfe00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Mefer_0876   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Mefer_0876  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mfe03011]     Mefer_0876    04121 Ubiquitin system [BR:mfe04121]     Mefer_0876   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mfe04147]     Mefer_0876 Ribosome [BR:mfe03011]  Ribosomal proteins   Eukaryotes    Small subunit     Mefer_0876   Archaea     Mefer_0876 Ubiquitin system [BR:mfe04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Mefer_0876 Exosome [BR:mfe04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Mefer_0876   Exosomal proteins of colorectal cancer cells    Mefer_0876 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Rcat_RNF216 Ribosomal_L37e Zn_ribbon_Nudix Cas12f1-like_TNB Zn_ribbon_IS1595 Zn_ribbon_RPB9 Alsin_RLD Motif Other DBs NCBI-ProteinID:  ACV24694 UniProt:  C7P812 LinkDB All DBs Position 826905..827087 Genome browser AA seq 60 aa AA seqDB search MTKGKKTAKYKYYKIEGDKVVRLKKVCPRCGPGVFMAEHLNRYACGKCGYMEWKQPQKNE NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atgacaaaagggaaaaaaacagcaaaatacaaatactacaaaattgaaggagacaaagtt gttagattaaagaaggtttgtccaagatgtggtccaggagttttcatggctgagcactta aacagatacgcatgtggaaaatgtggctatatggaatggaaacagccacaaaagaatgaa tag

DBGET integrated database retrieval system