Methanobacterium formicicum DSM1535: DSM1535_0594 Help Entry DSM1535_0594      CDS       T03743                                  Name (GenBank) hypothetical protein   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mfi  Methanobacterium formicicum DSM1535 Pathway mfi03010   Ribosome Brite KEGG Orthology (KO) [BR:mfi00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     DSM1535_0594   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     DSM1535_0594  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mfi03011]     DSM1535_0594    04121 Ubiquitin system [BR:mfi04121]     DSM1535_0594   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mfi04147]     DSM1535_0594 Ribosome [BR:mfi03011]  Ribosomal proteins   Eukaryotes    Small subunit     DSM1535_0594   Archaea     DSM1535_0594 Ubiquitin system [BR:mfi04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    DSM1535_0594 Exosome [BR:mfi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    DSM1535_0594   Exosomal proteins of colorectal cancer cells    DSM1535_0594 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 NCD3G Alsin_RLD Motif Other DBs NCBI-ProteinID:  CEA12955 UniProt:  A0A089ZEZ4 LinkDB All DBs Position 1:596152..596316 Genome browser AA seq 54 aa AA seqDB search MKKFELYEVKDNKIIRKNPECVRCSHGVFMADHGDRYACGKCGYTQWKGKEGKK NT seq 165 nt NT seq  +upstreamnt  +downstreamnt atgaaaaaatttgaattgtacgaagttaaagataacaaaatcatccgtaaaaacccagaa tgtgtacgatgctcccatggtgtcttcatggccgatcatggagaccgttacgcctgtgga aaatgcggttacacccagtggaaaggtaaagaaggtaagaaataa

DBGET integrated database retrieval system