Methanofollis formosanus: E2N92_06450 Help Entry E2N92_06450       CDS       T09788                                  Name (GenBank) ribonuclease P protein subunit   KO K03538   ribonuclease P protein subunit POP4 [EC:3.1.26.5] Organism mfk  Methanofollis formosanus Pathway mfk03008   Ribosome biogenesis in eukaryotes Brite KEGG Orthology (KO) [BR:mfk00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     E2N92_06450  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:mfk03009]     E2N92_06450    03016 Transfer RNA biogenesis [BR:mfk03016]     E2N92_06450    03029 Mitochondrial biogenesis [BR:mfk03029]     E2N92_06450 Enzymes [BR:mfk01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.26  Endoribonucleases producing 5'-phosphomonoesters     3.1.26.5  ribonuclease P      E2N92_06450 Ribosome biogenesis [BR:mfk03009]  Eukaryotic type   Pre-60S particles    RNases     RNase MRP      E2N92_06450 Transfer RNA biogenesis [BR:mfk03016]  Eukaryotic type   5'processing factors    Ribonucrease P     E2N92_06450 Mitochondrial biogenesis [BR:mfk03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial transcription and translation factors    RNase MRP     E2N92_06450 SSDB OrthologParalogGFIT Motif Pfam:  RNase_P-MRP_p29 PIN_halo SH3_YKFC_2nd Motif Other DBs NCBI-ProteinID:  QYZ79096 UniProt:  A0A8G1EGF4 LinkDB All DBs Position complement(1444525..1444800) Genome browser AA seq 91 aa AA seqDB search MITPQTLLRHEFTGLAVSVVKARNPAYVGISGRIVDETRNMLAVLTPAGEKKVEKKDTVF RFTLPDGVCAEVDGSALVARPEKRISMRKTR NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgatcacaccgcagaccctccttcggcacgagttcaccggacttgcagtctctgtggtg aaggccaggaacccggcatatgtcgggatatcgggccggatagtagatgagactcgcaat atgctggcggtcctcacccctgcgggagagaagaaggtggagaagaaagacaccgtcttt cgcttcacccttcccgacggggtatgcgccgaagtggatgggtctgcccttgtggcacga cctgaaaaacggatcagcatgcgcaaaaccagatag

DBGET integrated database retrieval system