Methanofollis formosanus: E2N92_07270 Help Entry E2N92_07270       CDS       T09788                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mfk  Methanofollis formosanus Pathway mfk03010   Ribosome Brite KEGG Orthology (KO) [BR:mfk00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     E2N92_07270   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     E2N92_07270  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mfk03011]     E2N92_07270    04121 Ubiquitin system [BR:mfk04121]     E2N92_07270   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mfk04147]     E2N92_07270 Ribosome [BR:mfk03011]  Ribosomal proteins   Eukaryotes    Small subunit     E2N92_07270   Archaea     E2N92_07270 Ubiquitin system [BR:mfk04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    E2N92_07270 Exosome [BR:mfk04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    E2N92_07270   Exosomal proteins of colorectal cancer cells    E2N92_07270 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_Nudix Ribosomal_L37e IBR DUF1451 IBR_1 Zn_ribbon_RPAB4 Rcat_RNF216 Baculo_ME53 Zn_ribbon_IS1595 zf-C2H2_ZN142 Zn_ribbon_11 Cas12f1-like_TNB Lar_restr_allev Motif Other DBs NCBI-ProteinID:  QYZ79252 UniProt:  A0A8G1A141 LinkDB All DBs Position 1610864..1611049 Genome browser AA seq 61 aa AA seqDB search MAAKKGAAPAAAVKRSAFFKVEGETAVPQRKYCPRCGPGVFLAQHKDRLACGKCGYTEFT K NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggcggcaaagaagggagcggcccccgcggcagcggtcaagcggagcgcattcttcaag gtcgagggcgagacggctgtgccgcagcggaagtactgtccgcggtgcggccccggcgtc ttcctggcccagcacaaggaccgccttgcctgtgggaagtgcggctatactgagttcacc aaataa

DBGET integrated database retrieval system